Recently booked pinal county. He was charged with Dangerous Drug-Poss/Use.
Recently booked pinal county He was 21 years old on the day of the booking. He was charged with Shoplifting. ALBERT ARZAGA was booked on 1/30/2024 in Pinal County, Arizona. He was charged with Refuse Tele Partyline-Emerg. He was 27 years old on the day of the DANIEL SCHMITT was booked on 11/12/2023 in Pinal County, Arizona. He was charged with Fightng, Disruptv Behavior Dv. He was 67 years old on the day of the booking. SHAQUILLE BRAXTON was booked on 12/31/2022 in Pinal County, Arizona. He was charged with SEXUAL CONDUCT WITH MINOR. He was 61 years old on the day of the booking. | Recently MICHAEL STEWART was booked on 4/30/2024 in Pinal County, Arizona. MICHAEL SICORA was booked on 11/27/2023 in Pinal County, Arizona. BERNARD LEDBETTER was booked on 8/8/2024 in Pinal County, Arizona. MARIO CORTEZ was booked on 8/28/2024 in Pinal County, Arizona. NICHOLAS MELENUDO was booked on 5/18/2023 in Pinal County, Arizona. Recent Arrest Information for Pinal County Arizona. AUSTIN DAVIS was booked on 4/18/2024 in Pinal County, Arizona. He was 46 years old on the day of the booking. He was charged with Drug Paraphernalia-Possess/Use. He was charged with THREAT-INTIM W/INJ-DMGE PROP. He was 56 years old on the day of the booking. She was charged with Conspiracy. Thursday Juan Salazar, 32, was arrested on suspicion of Visit the Pinal County Sheriff's Office website. He was charged with Dui W/Bac Of . ETHAN NORTON was booked on 5/17/2023 in Pinal County, Arizona. | Recently ORLANDO RUIZ was booked on 3/4/2024 in Pinal County, Arizona. STEVEN MORALES was booked on 2/14/2024 in Pinal County, Arizona. He was charged with DISORD CONDUCT-WEAPON/INSTR. ISAAC BARRETT was booked on 7/17/2024 in Pinal County, Arizona. CODY CHACON was booked on 5/13/2024 in Pinal County, Arizona. JEFFERY MEYHOFF was booked on 11/12/2023 in Pinal County, Arizona. He was charged with Forgery-Poss Forged Instrument. HUNTER BOWMAN was booked on 11/4/2023 in Pinal County, Arizona. He was 39 years old on the day of the booking. 20. ROY WHEELER was booked on 7/9/2024 in Pinal County, Arizona. She was charged with Murder 2Nd Deg-Ext Indiffrence. He was charged with Fail Register As Sex Offender. He was 82 years old on the day of the booking. Constantly updated. He was 23 years old on the day of the booking. Find Inmate rosters, recent arrests, mugshots of offenders in Pinal County, Arizona. 2nd St. He was charged with Probation Violation. Enter the inmate's name or booking number. He was charged with Fugitive Of Justice. She was charged with Warrant. ELIZABETH MORGAN was booked on 7/9/2024 in Pinal County, Arizona. FLETCHER OTEY was booked on 8/6/2024 in Pinal County, Arizona. Results also include Booking Id, Charges, Booking Date, Location, Bond, Reporting Agency, Gender, Age, To find out if someone you know has been recently arrested and booked into the Pinal County Jail, call the jail’s booking line at 855-355-0358. KEVEN REEDER was booked on 12/26/2023 in Pinal County, Arizona. She was 47 years old on the day of the booking. He was 35 years old on the day of the booking. He was charged with Agg Aslt-Corrections Employee. He was charged with Disorderly Conduct-Fighting. He was 76 years old on the day of the booking. | Recently SCOTT RUSSELL was booked on 5/15/2024 in Pinal County, Arizona. He was charged with Narcotic Drug-Possess/Use. EDWIN CANGIN was booked on 11/21/2023 in Pinal County, Arizona. | CODY HEATH was booked on 8/9/2023 in Pinal County, Arizona. | Recently JAVIER LOPEZ was booked on 4/12/2024 in Pinal County, Arizona. JOHNNIE SMITH was booked on 6/27/2024 in Pinal County, Arizona. | Recently Booked MIGUEL HERNANDEZ EVANGELISTA was booked on 9/2/2023 in Pinal County, Arizona. Recently Booked - View Mugshots In Your Local Area. Largest Database of Pinal County Mugshots. JASON GULLEY was booked on 3/10/2024 in Pinal County, Arizona. Navigate to the 'Inmate Search' section. JENNA COFFMAN was booked on 10/25/2023 in Pinal County, Arizona. ABBEY COCHRAN was booked on 9/5/2024 in Pinal County, Arizona. He was 30 years old on the day of the booking. The search results Pinal County Arizona Recently Booked. He was charged with Drug Paraphernalia Violation. She was charged with Failure To Appear In 2Nd Deg. He was 55 years old on the day of the booking. He was charged with Aggravated Harassment. He was 32 years old on the day of the booking. RAYMOND FRENCH was booked on 6/11/2024 in Pinal County, Arizona. BRADY STEWART was booked on 7/8/2024 in Pinal County, Arizona. He was 43 years old on the day of the ANTHONY CARDENAS was booked on 3/18/2024 in Pinal County, Arizona. He was 28 years old on the day of the booking. He was charged with Poss Wpn By Prohib Person. He was charged with Burglary 3Rd Deg-Unlaw Entry. He was 18 years old on the day of the booking. He was charged with Kidnap-Ransom/Hostage. TAYLOR VALENTINE was booked on 11/24/2021 in Pinal County, Arizona. He was 30 years old on the day of the ESHAUN COX was booked on 12/31/2022 in Pinal County, Arizona. He was charged with Assault-Intent/Reckless/Injure. He was 44 years old on the day of the booking. BRAEDON HARTMAN was booked on 4/3/2024 in Pinal County, Arizona. | JOSEPH HELTON was booked on 4/30/2024 in Pinal County, Arizona. JAMES BANNON was booked on 5/14/2024 in Pinal County, Arizona. ENRIQUE GARZA was booked on 3/26/2022 in Pinal County, Arizona. He was charged with Theft-Control Property. TREVA ZELLERS was booked on 8/11/2024 in Pinal County, Arizona. He was charged with Reckless Driving. WILLIAM SMITH was booked on 11/8/2023 in Pinal County, Arizona. TAMMY WARD was booked on 2/1/2024 in Pinal County, Arizona. He was 20 years old on the day of the booking. He was 75 years old on the day of the booking. JASON CASEY was booked on 11/16/2023 in Pinal County, Arizona. She was charged with Court. CHRISTINE STEVENSON was booked on 8/17/2024 in Pinal County, Arizona. He was charged with Sexual Abuse. He was 48 years old on the day of the booking. She was 61 years old on the day of the booking. He was charged with SEXUAL ASSAULT. The Pinal County Sheriff’s Office reported the following people booked into the Pinal County Adult Detention Center. He was 34 years old on the day of the JUSTIN HALL was booked on 8/19/2024 in Pinal County, Arizona. | LOGAN WALL HARRIS was booked on 2/20/2023 in Pinal County, Arizona. He was charged with Dui/Drugs/Metabolite. She was 35 years old on the day of the booking. He was charged with Molestation Of Child. THERESA MILLER was booked on 8/6/2024 in Pinal County, Arizona. He was charged with Dui Liquor/Drugs/Vapors/Combo. He was charged with Murder 1St Deg-Premeditated. She was 44 years old on the day of the booking. 1,921 likes · 5 talking about this. | MITCHELL KLOTZ was booked on 6/11/2024 in Pinal County, Arizona. She was charged with Manslaughter-Reckless. This is a social-media hub curated for engagement by Pinal Central staff. There may be an automated method of looking them up by their name over the phone, or you This search is currently offline. | How do I find out if someone has been arrested and booked into the Pinal County Jail? To find out if someone you know has been recently arrested and booked into the Pinal County Jail, call the jail’s booking line at 855-355-0358. She was 43 years old on the day of the COLBY BREWER was booked on 1/22/2024 in Pinal County, Arizona. CARLOS MENA was booked on 5/27/2023 in Pinal County, Arizona. CHRISTOPHER MERRILL was booked on 1/20/2024 in Pinal County, Arizona. He was 40 years old on the day of the booking. | Pinal; Yavapai; Yuma; The following list All data on this site is obtained directly from law enforcement agencies in their respective states and counties, and is public domain. Easily search the latest arrests and see their mugshots in your local area. 08 Or More. WILLIAM TUEY was booked on 1/18/2022 in Pinal County, Arizona. | JOHN STATHAKIS was booked on 7/19/2023 in Pinal County, Arizona. He was charged with Driver'S License Violation. He was charged with Dangerous Drug-Poss For Sale. She was 59 years old on the day of the booking. He was 74 years old on the day of the booking. MARIO TIZOC was booked on 4/14/2024 in Pinal County, Arizona. He was 24 years old on the day of the booking. He was 31 years old on the day of the booking. He was charged with Narcotic Drug Violation. He was charged with Warrant. JASON AVERY was booked on 6/28/2023 in Pinal County, Arizona. He was charged with FAILURE TO APPEAR IN 2ND DEG. COLTON BERGER was booked on 4/1/2024 in Pinal County, Arizona. He was 22 years old on the day of the booking. | ORLANDO MORALES was booked on 7/17/2023 in Pinal County, Arizona. Maricopa County is the central county of the Phoenix-Mesa-Chandler, AZ BRANDON RAMSEY was booked on 6/18/2024 in Pinal County, Arizona. She was 36 years old on the day of the booking. He was 19 years old on the day of the booking. She was 38 years old on the day of the JAMES RIKER was booked on 1/26/2024 in Pinal County, Arizona. JUSTIN JOHNSON was booked on 7/12/2024 in Pinal County, Arizona. She was 62 years old on the day of the booking. Public inquiries regarding inmates may call the Jail Inmate Information number at JUSTIN CAMPBELL was booked on 3/31/2024 in Pinal County, Arizona. With a few simple clicks, filter by state and/or county, or DAVID RUIZ was booked on 1/21/2023 in Pinal County, Arizona. He was 34 years old on the day of the booking. He was 52 years old on the day of the DIANA GIBSON was booked on 6/23/2024 in Pinal County, Arizona. He was charged with Court. JOHN ASHER was booked on 11/24/2023 in Pinal County, Arizona. SHAQUILLE BRAXTON was booked on 12/28/2023 in Pinal County, Arizona. com 200 W. He was 60 years old on the day of the booking. He was 37 years old on the day of the booking. He was charged with Manslaughter-Reckless. Click ‘Search’ to retrieve the results. He was charged with Failure To Pay Fine. He was charged with Dangerous Drug-Poss/Use. BRANDON PAGE was booked on 3/25/2024 in Pinal County, Arizona. STARLEX DORCELY was booked on 6/14/2024 in Pinal County, Arizona. She was 54 years old on the day of the booking. He was 26 years old on the day of the booking. He was charged with Threat-Intim W/Inj-Dmge Prop. She was 43 years old on the day of the booking. . Media requests may be submitted using our Records Request Portal. He was charged with Criminal Damage-Deface. CODY FOWLER was booked on 4/28/2024 in Pinal County, Arizona. He was charged with Disorderly Conduct. CHANDA ECKERT was booked on 3/25/2024 in Pinal County, Arizona. He was charged with Fail To Comply W Court Order. LAKEISHA WILLIAMS was booked on 3/20/2023 in Pinal County, Arizona. The county seat is Phoenix, the state capital and fifth-most populous city in the United States. | KATHRYN SMITH was booked on 6/6/2024 in Pinal County, Arizona. She was charged with Assault-Intent/Reckless/Injure. com The following was taken from the records at the Coolidge Police Department. SEAN GALLAGHER was booked on 5/21/2024 in Pinal County, Arizona. She was charged with Probation Violation. He was 90 years old on the day of the booking. JACK KNOTTER was booked on 8/7/2023 in Pinal County, Arizona. He was 25 years old on the day of the booking. | CHARLES ANDRUS was booked on 4/18/2024 in Pinal County, Arizona. | BARBARA ARMSTRONG was booked on 2/15/2024 in Pinal County, Arizona. Casa Grande, AZ 85122 Phone: 520-836-7461 Email: web@pinalcentral. She was 41 years old on the day of the booking. LILIAN CROW was booked on 9/5/2024 in Pinal County, Arizona. She was charged with Dui Liquor/Drugs/Vapors/Combo. She was 32 years old on the day of the booking. He was charged with Narcotic Drug-Possess For Sale. He was 20 years old on the day of the HUNTER BRUSH was booked on 1/3/2024 in Pinal County, Arizona. FRANCIS FLAHERTY was booked on 7/4/2024 in Pinal County, Arizona. He was charged with Failure To Appear In 1St Deg. He was 42 years old on the day of the booking. He was charged with Sexual Exploitation Of Minor. He was 31 years old on the day of MICHAEL DOW was booked on 6/10/2024 in Pinal County, Arizona. He was 29 years old on the day of the booking. TAUNA MCWHORTOR was booked on 5/29/2024 in Pinal County, Arizona. He was 50 years old on the day of the booking. He was 34 years old on the day of the BENJAMIN HAMILTON was booked on 5/2/2024 in Pinal County, Arizona. | Recently RUSSELL BERTHELETTE was booked on 5/14/2024 in Pinal County, Arizona. She was 27 years old on the day of the booking. TYLER SETTLES was booked on 6/14/2024 in Pinal County, Arizona. Find latests mugshots and bookings from San Tan Valley and other local cities. CHRIS WODKA was booked on 5/10/2024 in Pinal County, Arizona. He was charged with Agg Ass-Deadly Wpn/Dang Inst. He was charged with Endangerment. RANDAL PHELPS was booked on 7/16/2024 in Pinal County, Arizona. There may MICHELLE ALVARADO was booked on 5/7/2024 in Pinal County, Arizona. He was charged with Sexual Conduct With Minor. She was charged with Super Extreme Dui-Bac>. MINDY DILLINGHAM was booked on 7/18/2024 in Pinal County, Arizona. He was charged with AGG ASLT-PEACE/LAW OFFICER. PinalCentral. He was charged with Kidnap-Death/Inj/Sex/Aid Fel. okvfhderswhfvmwenygmtlmevaggwrfyyrlsrrbtxnncndfivwtoflkeepygsqtjjdydhlxijqsndf